![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
![]() | Protein automated matches [226843] (8 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [327472] (2 PDB entries) |
![]() | Domain d5mn5b2: 5mn5 B:209-315 [327494] Other proteins in same PDB: d5mn5a1, d5mn5b1 automated match to d4dxda2 complexed with gtp |
PDB Entry: 5mn5 (more details), 2.8 Å
SCOPe Domain Sequences for d5mn5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mn5b2 d.79.2.0 (B:209-315) automated matches {Staphylococcus aureus [TaxId: 1280]} ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
Timeline for d5mn5b2: