Lineage for d1cqha_ (1cqh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876344Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)
  8. 2876374Domain d1cqha_: 1cqh A: [32749]
    mutant

Details for d1cqha_

PDB Entry: 1cqh (more details)

PDB Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human ref-1 (residues 59-71 of the p50 subunit of nfkb), nmr, minimized average structure
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1cqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqha_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d1cqha_:

Click to download the PDB-style file with coordinates for d1cqha_.
(The format of our PDB-style files is described here.)

Timeline for d1cqha_: