Lineage for d5t6mb_ (5t6m B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907681Protein automated matches [190054] (13 species)
    not a true protein
  7. 2907773Species Pyrococcus furiosus [TaxId:2261] [327480] (1 PDB entry)
  8. 2907775Domain d5t6mb_: 5t6m B: [327487]
    Other proteins in same PDB: d5t6mc2
    automated match to d1v8zb_
    complexed with 78u, na, po4

Details for d5t6mb_

PDB Entry: 5t6m (more details), 1.8 Å

PDB Description: structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound
PDB Compounds: (B:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5t6mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6mb_ c.79.1.1 (B:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvsg

SCOPe Domain Coordinates for d5t6mb_:

Click to download the PDB-style file with coordinates for d5t6mb_.
(The format of our PDB-style files is described here.)

Timeline for d5t6mb_: