Lineage for d1eru__ (1eru -)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 180867Family c.47.1.1: Thioltransferase [52834] (6 proteins)
  6. 180897Protein Thioredoxin [52835] (7 species)
  7. 180923Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries)
  8. 180929Domain d1eru__: 1eru - [32748]

Details for d1eru__

PDB Entry: 1eru (more details), 2.1 Å

PDB Description: human thioredoxin (oxidized form)

SCOP Domain Sequences for d1eru__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eru__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

SCOP Domain Coordinates for d1eru__:

Click to download the PDB-style file with coordinates for d1eru__.
(The format of our PDB-style files is described here.)

Timeline for d1eru__: