| Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
| Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (2 proteins) |
| Protein Thioredoxin [52835] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries) |
| Domain d1auc__: 1auc - [32747] |
PDB Entry: 1auc (more details), 2.1 Å
SCOP Domain Sequences for d1auc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auc__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
Timeline for d1auc__: