Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (26 species) not a true protein |
Species Aspergillus niger [TaxId:5061] [260290] (4 PDB entries) |
Domain d5i77a1: 5i77 A:31-331 [327443] Other proteins in same PDB: d5i77a2 automated match to d1gzja_ complexed with ca, nag, peg, pge |
PDB Entry: 5i77 (more details), 1.8 Å
SCOPe Domain Sequences for d5i77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i77a1 c.1.8.3 (A:31-331) automated matches {Aspergillus niger [TaxId: 5061]} vfewfgsnesgaefgtnipgvwgtdyifpdpsaistlidkgmnffrvqfmmerllpdsmt gsydeeylanlttvikavtdggahalvdphnygryngeiisstsdfqtfwenlagqykdn dlvmfdtnneyhdmdqdlvlnlnqaaingiraagatsqyifvegnswtgawtwvdvndnm knltdpedkivyemhqyldsdgsgtsetcvsetigkervteatqwlkdnkkvgfigeyag gsndvcrsavsgmleymanntdvwkgaswwaagpwwgdyifsleppdgtaytgmldilea y
Timeline for d5i77a1: