Lineage for d5i77a1 (5i77 A:31-331)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (26 species)
not a true protein
Species Aspergillus niger [TaxId:5061] [260290] (4 PDB entries) 
Domain d5i77a1: 5i77 A:31-331 [327443]
Other proteins in same PDB: d5i77a2
automated match to d1gzja_
complexed with ca, nag, peg, pge
Details for d5i77a1
PDB Entry: 5i77 (more details), 1.8 Å
PDB Description: crystal structure of a beta-1,4-endoglucanase from aspergillus niger
PDB Compounds: (A:) Endo-beta-1, 4-glucanaseSCOPe Domain Sequences for d5i77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i77a1 c.1.8.3 (A:31-331) automated matches {Aspergillus niger [TaxId: 5061]}
vfewfgsnesgaefgtnipgvwgtdyifpdpsaistlidkgmnffrvqfmmerllpdsmt
gsydeeylanlttvikavtdggahalvdphnygryngeiisstsdfqtfwenlagqykdn
dlvmfdtnneyhdmdqdlvlnlnqaaingiraagatsqyifvegnswtgawtwvdvndnm
knltdpedkivyemhqyldsdgsgtsetcvsetigkervteatqwlkdnkkvgfigeyag
gsndvcrsavsgmleymanntdvwkgaswwaagpwwgdyifsleppdgtaytgmldilea
y
SCOPe Domain Coordinates for d5i77a1:
Click to download the PDB-style file with coordinates for d5i77a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5i77a1:
- d5i77a1 is new in SCOPe 2.06-stable
- d5i77a1 appears in SCOPe 2.07
- d5i77a1 appears in the current release, SCOPe 2.08
View in 3D
