Lineage for d1ert__ (1ert -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.1: Thioltransferase [52834] (6 proteins) 
Protein Thioredoxin [52835] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries) 
Domain d1ert__: 1ert - [32744]
Details for d1ert__
PDB Entry: 1ert (more details), 1.7 Å
PDB Description: human thioredoxin (reduced form)
SCOP Domain Sequences for d1ert__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ert__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
SCOP Domain Coordinates for d1ert__:
Click to download the PDB-style file with coordinates for d1ert__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ert__:
- d1ert__ first appeared (with stable ids) in SCOP 1.55
- d1ert__ appears in SCOP 1.57
- d1ert__ appears in SCOP 1.61
- d1ert__ appears in the current release, SCOPe 2.08, called d1erta_
View in 3D