| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein Retinal dehydrogenase/reductase 3 [141907] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141908] (15 PDB entries) Uniprot Q9BPX1 4-253 |
| Domain d5l7ta1: 5l7t A:4-256 [327438] Other proteins in same PDB: d5l7ta2 automated match to d1ydef_ complexed with 6qj, na, nad |
PDB Entry: 5l7t (more details), 1.98 Å
SCOPe Domain Sequences for d5l7ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l7ta1 c.2.1.2 (A:4-256) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgygck
Timeline for d5l7ta1: