![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Interleukin-13 (IL-13) [63532] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries) |
![]() | Domain d5l6yc_: 5l6y C: [327425] Other proteins in same PDB: d5l6yh_, d5l6yl1, d5l6yl2 automated match to d5e4ea_ complexed with fmt |
PDB Entry: 5l6y (more details), 1.99 Å
SCOPe Domain Sequences for d5l6yc_:
Sequence, based on SEQRES records: (download)
>d5l6yc_ a.26.1.2 (C:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]} ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq rmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
>d5l6yc_ a.26.1.2 (C:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]} ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq rmlsgfcdtkievaqfvkdlllhlkklfregrfn
Timeline for d5l6yc_: