Lineage for d5gzea_ (5gze A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390546Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)
  8. 2390564Domain d5gzea_: 5gze A: [327414]
    automated match to d4bmea_
    complexed with lat

Details for d5gzea_

PDB Entry: 5gze (more details), 1.32 Å

PDB Description: galectin-8 n-terminal domain carbohydrate recognition domain
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d5gzea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzea_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsfs

SCOPe Domain Coordinates for d5gzea_:

Click to download the PDB-style file with coordinates for d5gzea_.
(The format of our PDB-style files is described here.)

Timeline for d5gzea_: