Lineage for d1fb0a_ (1fb0 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.1: Thioltransferase [52834] (2 proteins) 
Protein Thioredoxin [52835] (7 species) 
Species Spinach (Spinacia oleracea), thioredoxin M [TaxId:3562] [52841] (2 PDB entries) 
Domain d1fb0a_: 1fb0 A: [32741]
Details for d1fb0a_
PDB Entry: 1fb0 (more details), 2.26 Å
PDB Description: crystal structure of thioredoxin m from spinach chloroplast (reduced form)
SCOP Domain Sequences for d1fb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fb0a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M}
evqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntde
apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl
SCOP Domain Coordinates for d1fb0a_:
Click to download the PDB-style file with coordinates for d1fb0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fb0a_:
- d1fb0a_ appears in SCOP 1.57
- d1fb0a_ appears in the current release, SCOPe 2.08
View in 3D
