![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
![]() | Protein automated matches [191197] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries) |
![]() | Domain d5kpnb2: 5kpn B:797-1011 [327407] Other proteins in same PDB: d5kpna1, d5kpna3, d5kpnb1, d5kpnb3 automated match to d4hhyd2 complexed with 6wx |
PDB Entry: 5kpn (more details), 2.3 Å
SCOPe Domain Sequences for d5kpnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kpnb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d5kpnb2: