Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (23 species) not a true protein |
Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327398] (1 PDB entry) |
Domain d5k9ki2: 5k9k I:335-501 [327399] Other proteins in same PDB: d5k9kb1, d5k9kb2, d5k9kf1, d5k9ki1, d5k9kl1, d5k9kl2 automated match to d1ha0a2 complexed with bma, man, nag |
PDB Entry: 5k9k (more details), 2.97 Å
SCOPe Domain Sequences for d5k9ki2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k9ki2 h.3.1.0 (I:335-501) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} iagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekfhq iekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektrrq lrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
Timeline for d5k9ki2: