Lineage for d5k9ki2 (5k9k I:335-501)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267772Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327398] (1 PDB entry)
  8. 2267774Domain d5k9ki2: 5k9k I:335-501 [327399]
    Other proteins in same PDB: d5k9kb1, d5k9kb2, d5k9kf1, d5k9ki1, d5k9kl1, d5k9kl2
    automated match to d1ha0a2
    complexed with bma, man, nag

Details for d5k9ki2

PDB Entry: 5k9k (more details), 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.
PDB Compounds: (I:) Hemagglutinin

SCOPe Domain Sequences for d5k9ki2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9ki2 h.3.1.0 (I:335-501) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
iagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekfhq
iekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektrrq
lrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d5k9ki2:

Click to download the PDB-style file with coordinates for d5k9ki2.
(The format of our PDB-style files is described here.)

Timeline for d5k9ki2: