| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.1: Resolvase-like [53041] (2 families) ![]() automatically mapped to Pfam PF00239 |
| Family c.53.1.0: automated matches [227230] (1 protein) not a true family |
| Protein automated matches [226976] (3 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries) |
| Domain d5c31c_: 5c31 C: [327396] automated match to d2rslb_ complexed with so4 |
PDB Entry: 5c31 (more details), 3.1 Å
SCOPe Domain Sequences for d5c31c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c31c_ c.53.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
seqer
Timeline for d5c31c_: