Lineage for d5i4fa2 (5i4f A:138-251)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) 
Domain d5i4fa2: 5i4f A:138-251 [327373]
automated match to d4h0hb2
Details for d5i4fa2
PDB Entry: 5i4f (more details), 1.55 Å
PDB Description: scfv 2d10 complexed with alpha 1,6 mannobiose
PDB Compounds: (A:) scFv 2D10SCOPe Domain Sequences for d5i4fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4fa2 b.1.1.0 (A:138-251) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsdvvmtqtpfslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsn
rfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpytfgggtkleik
SCOPe Domain Coordinates for d5i4fa2:
Click to download the PDB-style file with coordinates for d5i4fa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5i4fa2:
- d5i4fa2 first appeared in SCOPe 2.06
- d5i4fa2 appears in SCOPe 2.07
View in 3D
