Lineage for d1f9mb_ (1f9m B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24117Family c.47.1.1: Thioltransferase [52834] (2 proteins)
  6. 24138Protein Thioredoxin [52835] (7 species)
  7. 24178Species Spinach (Spinacia oleracea), thioredoxin F [TaxId:3562] [52840] (2 PDB entries)
  8. 24180Domain d1f9mb_: 1f9m B: [32737]

Details for d1f9mb_

PDB Entry: 1f9m (more details), 1.86 Å

PDB Description: crystal structure of thioredoxin f from spinach chloroplast (short form)

SCOP Domain Sequences for d1f9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9mb_ c.47.1.1 (B:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F}
meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars

SCOP Domain Coordinates for d1f9mb_:

Click to download the PDB-style file with coordinates for d1f9mb_.
(The format of our PDB-style files is described here.)

Timeline for d1f9mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f9ma_