![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.2: Thermolysin-like [55490] (5 proteins) includes alpha-helical C-terminal domain characteristic for the family |
![]() | Protein Thermolysin [63414] (3 species) |
![]() | Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (172 PDB entries) Uniprot P00800 |
![]() | Domain d5jsse_: 5jss E: [327361] automated match to d1kkka_ complexed with 6ng, ca, dms, gol, zn |
PDB Entry: 5jss (more details), 1.19 Å
SCOPe Domain Sequences for d5jsse_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jsse_ d.92.1.2 (E:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]} itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts qevasvkqafdavgvk
Timeline for d5jsse_: