Lineage for d5jsse_ (5jss E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2204997Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2205011Protein Thermolysin [63414] (3 species)
  7. 2205012Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (172 PDB entries)
    Uniprot P00800
  8. 2205033Domain d5jsse_: 5jss E: [327361]
    automated match to d1kkka_
    complexed with 6ng, ca, dms, gol, zn

Details for d5jsse_

PDB Entry: 5jss (more details), 1.19 Å

PDB Description: thermolysin in complex with jc149.
PDB Compounds: (E:) thermolysin

SCOPe Domain Sequences for d5jsse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jsse_ d.92.1.2 (E:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d5jsse_:

Click to download the PDB-style file with coordinates for d5jsse_.
(The format of our PDB-style files is described here.)

Timeline for d5jsse_: