Lineage for d5iunf_ (5iun F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115118Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)
  8. 2115129Domain d5iunf_: 5iun F: [327358]
    Other proteins in same PDB: d5iunc2
    automated match to d4le0b_
    complexed with acp, bef, mes, mg, so4

Details for d5iunf_

PDB Entry: 5iun (more details), 2.79 Å

PDB Description: crystal structure of the desk-desr complex in the phosphatase state
PDB Compounds: (F:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d5iunf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iunf_ c.23.1.0 (F:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelme

SCOPe Domain Coordinates for d5iunf_:

Click to download the PDB-style file with coordinates for d5iunf_.
(The format of our PDB-style files is described here.)

Timeline for d5iunf_: