Lineage for d5iulf_ (5iul F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464112Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)
  8. 2464127Domain d5iulf_: 5iul F: [327357]
    Other proteins in same PDB: d5iulc2
    automated match to d4le0b_
    complexed with acp, k, mg

Details for d5iulf_

PDB Entry: 5iul (more details), 3.15 Å

PDB Description: crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm) and bef3
PDB Compounds: (F:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d5iulf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iulf_ c.23.1.0 (F:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedly

SCOPe Domain Coordinates for d5iulf_:

Click to download the PDB-style file with coordinates for d5iulf_.
(The format of our PDB-style files is described here.)

Timeline for d5iulf_: