Lineage for d5ft4b_ (5ft4 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504726Species Escherichia coli K-12 [TaxId:83333] [226746] (6 PDB entries)
  8. 2504733Domain d5ft4b_: 5ft4 B: [327353]
    automated match to d4lw2a_
    complexed with cit, gol, plp

Details for d5ft4b_

PDB Entry: 5ft4 (more details), 2 Å

PDB Description: crystal structure of the cysteine desulfurase csda from escherichia coli at 1.996 angstroem resolution
PDB Compounds: (B:) cysteine desulfurase csda

SCOPe Domain Sequences for d5ft4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ft4b_ c.67.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
nvfnpaqfraqfpalqdagvyldsaatalkpeavveatqqfyslsagnvhrsqfaeaqrl
taryeaarekvaqllnapddktivwtrgttesinmvaqcyarprlqpgdeiivsvaehha
nlvpwlmvaqqtgakvvklplnaqrlpdvdllpelitprsrilalgqmsnvtggcpdlar
aitfahsagmvvmvdgaqgavhfpadvqqldidfyafsghklygptgigvlygksellea
mspwlgggkmvhevsfdgfttqsapwkleagtpnvagviglsaalewladydinqaesws
rslatlaedalakrpgfrsfrcqdssllafdfagvhhsdmvtllaeygialragqhcaqp
llaelgvtgtlrasfapyntksdvdalvnavdralellv

SCOPe Domain Coordinates for d5ft4b_:

Click to download the PDB-style file with coordinates for d5ft4b_.
(The format of our PDB-style files is described here.)

Timeline for d5ft4b_: