| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries) |
| Domain d5iunc1: 5iun C:1-130 [327349] Other proteins in same PDB: d5iunc2 automated match to d4le0b_ complexed with acp, bef, mes, mg, so4 |
PDB Entry: 5iun (more details), 2.79 Å
SCOPe Domain Sequences for d5iunc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iunc1 c.23.1.0 (C:1-130) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmed
Timeline for d5iunc1: