Lineage for d5gy3a_ (5gy3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722341Species Klebsiella pneumoniae [TaxId:573] [327331] (1 PDB entry)
  8. 2722342Domain d5gy3a_: 5gy3 A: [327332]
    automated match to d1wzza1

Details for d5gy3a_

PDB Entry: 5gy3 (more details), 1.77 Å

PDB Description: the crystal structure of endoglucanase cel10, a family 8 glycosyl hydrolase from klebsiella pneumoniae
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5gy3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gy3a_ a.102.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dtawerykarfmmpdgriidtangnvshtegqgfamllavanndrpafdklwqwtdstlr
dksnglfywrynpvapdpiadknnasdgdtliawallraqkqwqdkryaiasdaitasll
kytvvtfagrqvmlpgvkgfnlndhlnlnpsyfifpawrafaerthltawrtlqtdgqal
lgqmgwgkshlpsdwvalradgkmlpakewpprmsfdairiplylswadpqsallapwka
wmqsyprlqtpawinvstnevapwymaggllavrdltlgepqeapqiddkddyysaslkq
lvwlakqdqr

SCOPe Domain Coordinates for d5gy3a_:

Click to download the PDB-style file with coordinates for d5gy3a_.
(The format of our PDB-style files is described here.)

Timeline for d5gy3a_: