Lineage for d1tof__ (1tof -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.1: Thioltransferase [52834] (5 proteins) 
Protein Thioredoxin [52835] (7 species) 
Species Chlamydomonas reinhardtii [TaxId:3055] [52838] (2 PDB entries) 
Domain d1tof__: 1tof - [32733]
Details for d1tof__
PDB Entry: 1tof (more details)
PDB Description: thioredoxin h (oxidized form), nmr, 23 structures
SCOP Domain Sequences for d1tof__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tof__ c.47.1.1 (-) Thioredoxin {Chlamydomonas reinhardtii}
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
SCOP Domain Coordinates for d1tof__:
Click to download the PDB-style file with coordinates for d1tof__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tof__:
- d1tof__ first appeared (with stable ids) in SCOP 1.55
- d1tof__ appears in SCOP 1.59
- d1tof__ appears in the current release, SCOPe 2.08, called d1tofa_
View in 3D