SCOPe 2.08: Domain d5f89b2: 5f89 B:109-211

Lineage for d5f89b2 (5f89 B:109-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5f89b2: 5f89 B:109-211 [327323]
   Other proteins in same PDB: d5f89a_, d5f89b1, d5f89h_, d5f89l1
   automated match to d2fb4l2

Details for d5f89b2

PDB Entry: 5f89, 2.78 Å

PDB Description: structure of the unliganded fab from hiv-1 neutralising antibody cap248-2b that binds to the gp120 c-terminus - gp41 interface

PDB Compounds: (B:) CAP248-2B Light Chain

SCOPe Domain Sequences for d5f89b2:

Sequence; same for both SEQRES and ATOM records:

>d5f89b2 b.1.1.2 (B:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapte

Timeline for d5f89b2:

• d5f89b2 first appeared in SCOPe 2.06
  
• d5f89b2 appears in SCOPe 2.07