Lineage for d1thx__ (1thx -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.1: Thioltransferase [52834] (6 proteins) 
Protein Thioredoxin [52835] (7 species) 
Species Anabaena sp., pcc 7120 [TaxId:103690] [52837] (1 PDB entry) 
Domain d1thx__: 1thx - [32732]
Details for d1thx__
PDB Entry: 1thx (more details), 1.7 Å
PDB Description: thioredoxin-2
SCOP Domain Sequences for d1thx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1thx__ c.47.1.1 (-) Thioredoxin {Anabaena sp., pcc 7120}
skgvititdaefesevlkaeqpvlvyfwaswcgpcqlmsplinlaantysdrlkvvklei
dpnpttvkkykvegvpalrlvkgeqildstegviskdkllsfldthln
SCOP Domain Coordinates for d1thx__:
Click to download the PDB-style file with coordinates for d1thx__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1thx__:
- d1thx__ first appeared (with stable ids) in SCOP 1.55
- d1thx__ appears in SCOP 1.57
- d1thx__ appears in SCOP 1.61
- d1thx__ appears in the current release, SCOPe 2.08, called d1thxa_
View in 3D