Lineage for d1xoaa_ (1xoa A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. Protein Thioredoxin [52835] (16 species)
  7. Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. Domain d1xoaa_: 1xoa A: [32731]

Details for d1xoaa_

PDB Entry: 1xoa (more details)

PDB Description: thioredoxin (oxidized disulfide form), nmr, 20 structures
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1xoaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xoaa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d1xoaa_ are not available.

Timeline for d1xoaa_: