Lineage for d5c32d_ (5c32 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883014Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
    automatically mapped to Pfam PF00239
  5. 2883038Family c.53.1.0: automated matches [227230] (1 protein)
    not a true family
  6. 2883039Protein automated matches [226976] (3 species)
    not a true protein
  7. 2883043Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries)
  8. 2883063Domain d5c32d_: 5c32 D: [327303]
    automated match to d2rsla_
    complexed with so4

Details for d5c32d_

PDB Entry: 5c32 (more details), 3.05 Å

PDB Description: constitutively active sin recombinase cataltyic domain - i100t
PDB Compounds: (D:) Putative transposon Tn552 DNA-invertase bin3

SCOPe Domain Sequences for d5c32d_:

Sequence, based on SEQRES records: (download)

>d5c32d_ c.53.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnevtgnplldkfmkdliiqilamv
seqerne

Sequence, based on observed residues (ATOM records): (download)

>d5c32d_ c.53.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnplldkfmkdliiqilamvseqer
ne

SCOPe Domain Coordinates for d5c32d_:

Click to download the PDB-style file with coordinates for d5c32d_.
(The format of our PDB-style files is described here.)

Timeline for d5c32d_: