| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
| Protein automated matches [190781] (46 species) not a true protein |
| Species Aeromonas hydrophila [TaxId:380703] [327104] (5 PDB entries) |
| Domain d5b7na_: 5b7n A: [327301] automated match to d4qeza_ complexed with gol, sah |
PDB Entry: 5b7n (more details), 1.4 Å
SCOPe Domain Sequences for d5b7na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b7na_ c.56.2.0 (A:) automated matches {Aeromonas hydrophila [TaxId: 380703]}
sapiliqgamdvevetlvaalkdkqeltvgswtywqgtlsgypvvvsrtevglanaaaat
tlamerfqprlvinqgtagghdpalhrgdivigtksfnmgayrsdltpaeqgvdpskwhn
fevtmrlrdngklvehssfagdpelvgralgmadryrhgrvvpgiigtadewnrqvarin
wlhqtyqtaaeemetssaalvaeaykvpfvgirvlsntdlhgeefdpqtaihcqqfvidy
akalingf
Timeline for d5b7na_: