SCOPe 2.05: Domain d1srxa_: 1srx A:

Lineage for d1srxa_ (1srx A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (15 species)

7. Species Escherichia coli [TaxId:562] [52836] (48 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d1srxa_: 1srx A: [32729]
   CA-atoms only

Details for d1srxa_

PDB Entry: 1srx, 2.8 Å

PDB Description: three-dimensional structure of escherichia coli thioredoxin-s2 to 2.8 angstroms resolution

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1srxa_:

Sequence; same for both SEQRES and ATOM records:

>d1srxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdlvkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkyiergiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d1srxa_:

• d1srxa_ first appeared (with stable ids) in SCOP 1.55, called d1srx__
  
• d1srxa_ appears in SCOPe 2.04
  
• d1srxa_ appears in SCOPe 2.06
  
• d1srxa_ appears in the current release, SCOPe 2.08