Lineage for d5tism_ (5tis M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631923Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2631924Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 2631925Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 2631926Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries)
    Uniprot Q8DHA7 1-36
  8. 2631927Domain d5tism_: 5tis M: [327286]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axtm1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tism_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5tism_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tism_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesqq

SCOPe Domain Coordinates for d5tism_:

Click to download the PDB-style file with coordinates for d5tism_.
(The format of our PDB-style files is described here.)

Timeline for d5tism_: