SCOPe 2.06: Domain d5u2ka_: 5u2k A:

Lineage for d5u2ka_ (5u2k A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (30 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225621] (4 PDB entries)

8. Domain d5u2ka_: 5u2k A: [327282]
   automated match to d3ftta_
   complexed with cl, coa, edo, po4

Details for d5u2ka_

PDB Entry: 5u2k, 1.38 Å

PDB Description: crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)

PDB Compounds: (A:) galactoside o-acetyltransferase

SCOPe Domain Sequences for d5u2ka_:

Sequence; same for both SEQRES and ATOM records:

>d5u2ka_ b.81.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
vrkidndlps

Timeline for d5u2ka_:

• d5u2ka_ is new in SCOPe 2.06-stable
  
• d5u2ka_ appears in SCOPe 2.07
  
• d5u2ka_ appears in the current release, SCOPe 2.08