Lineage for d5tsqa_ (5tsq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903313Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2903314Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2903315Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
    automatically mapped to Pfam PF01156
  6. 2903356Protein automated matches [190287] (4 species)
    not a true protein
  7. 2903362Species Leishmania braziliensis [TaxId:1448350] [327267] (1 PDB entry)
  8. 2903363Domain d5tsqa_: 5tsq A: [327268]
    automated match to d1ezra_
    complexed with bdr, ca

Details for d5tsqa_

PDB Entry: 5tsq (more details), 1.53 Å

PDB Description: crystal structure of iunh from leishmania braziliensis in complex with d-ribose
PDB Compounds: (A:) IUnH

SCOPe Domain Sequences for d5tsqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tsqa_ c.70.1.1 (A:) automated matches {Leishmania braziliensis [TaxId: 1448350]}
prkiildcdpgiddavaillaygnpeiellaittvvgnqtlekvtrnaqlvadvagivgv
piaagcckplvrkvrtapqihgetglgtvsypsefktkldkrhavhliielimshepksi
tlvptggltniamaarleprivervkevvlmggsccignaspvaefnifvdpeaahivfn
eswdvtmvgldltsqalatpevlqrvkevrtkpadfilkilefytkvyetqrntyakvhd
pcavayvidptvmttnrvpvnielngeltagmtvtdfryprpeqchtqvaskldfskywd
lvidalqrigdp

SCOPe Domain Coordinates for d5tsqa_:

Click to download the PDB-style file with coordinates for d5tsqa_.
(The format of our PDB-style files is described here.)

Timeline for d5tsqa_: