Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) |
Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins) automatically mapped to Pfam PF01156 |
Protein automated matches [190287] (4 species) not a true protein |
Species Leishmania braziliensis [TaxId:1448350] [327267] (1 PDB entry) |
Domain d5tsqa_: 5tsq A: [327268] automated match to d1ezra_ complexed with bdr, ca |
PDB Entry: 5tsq (more details), 1.53 Å
SCOPe Domain Sequences for d5tsqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tsqa_ c.70.1.1 (A:) automated matches {Leishmania braziliensis [TaxId: 1448350]} prkiildcdpgiddavaillaygnpeiellaittvvgnqtlekvtrnaqlvadvagivgv piaagcckplvrkvrtapqihgetglgtvsypsefktkldkrhavhliielimshepksi tlvptggltniamaarleprivervkevvlmggsccignaspvaefnifvdpeaahivfn eswdvtmvgldltsqalatpevlqrvkevrtkpadfilkilefytkvyetqrntyakvhd pcavayvidptvmttnrvpvnielngeltagmtvtdfryprpeqchtqvaskldfskywd lvidalqrigdp
Timeline for d5tsqa_: