SCOPe 2.08: Domain d5tpwl1: 5tpw L:1-107

Lineage for d5tpwl1 (5tpw L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5tpwl1: 5tpw L:1-107 [327265]
   Other proteins in same PDB: d5tpwh_, d5tpwl2
   automated match to d1a5fl1
   complexed with gol, nag, so4, zn

Details for d5tpwl1

PDB Entry: 5tpw, 2.91 Å

PDB Description: crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in complex with zinc at the glun2a

PDB Compounds: (L:) Fab, light chain

SCOPe Domain Sequences for d5tpwl1:

Sequence, based on SEQRES records:

>d5tpwl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqapatlsvtpgdrvslscrasqsiadylywyqqkshesprlllkyasqsisgips
rfsgsgsgsdftltinsvepedvgmyycqnghsfprtfgggtkleik

Sequence, based on observed residues (ATOM records):

>d5tpwl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqapatlsvtpgdrvslscrasqsiadylywyqqkshesprlllkyaspsrfsgsg
sgsdftltinsvepedvgmyycqnghsfprtfgggtkleik

Timeline for d5tpwl1:

• d5tpwl1 first appeared in SCOPe 2.06
  
• d5tpwl1 appears in SCOPe 2.07