Lineage for d5lxym_ (5lxy M:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2559336Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2559337Protein automated matches [190896] (11 species)
    not a true protein
  7. 2559375Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)
  8. 2559467Domain d5lxym_: 5lxy M: [327253]
    automated match to d3ulha_
    protein/RNA complex; complexed with br

Details for d5lxym_

PDB Entry: 5lxy (more details), 2.85 Å

PDB Description: structure of the minimal rbm7 - zcchc8 complex
PDB Compounds: (M:) RNA-binding protein 7

SCOPe Domain Sequences for d5lxym_:

Sequence, based on SEQRES records: (download)

>d5lxym_ d.58.7.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpya
mnllngiklygrpikiqfr

Sequence, based on observed residues (ATOM records): (download)

>d5lxym_ d.58.7.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadrtlfvgnltkvtellfelfhqagpvikvqfafvnfkhevsvpyamnllngiklypik
iqfr

SCOPe Domain Coordinates for d5lxym_:

Click to download the PDB-style file with coordinates for d5lxym_.
(The format of our PDB-style files is described here.)

Timeline for d5lxym_: