Lineage for d1t7pb_ (1t7p B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.1: Thioltransferase [52834] (2 proteins) 
Protein Thioredoxin [52835] (7 species) Species Escherichia coli [TaxId:562] [52836] (9 PDB entries) 
Domain d1t7pb_: 1t7p B: [32723]
Other proteins in same PDB: d1t7pa1, d1t7pa2
Details for d1t7pb_
PDB Entry: 1t7p (more details), 2.2 Å
PDB Description: t7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin
SCOP Domain Sequences for d1t7pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t7pb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
SCOP Domain Coordinates for d1t7pb_:
Click to download the PDB-style file with coordinates for d1t7pb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t7pb_:
- d1t7pb_ appears in SCOP 1.57
- d1t7pb_ appears in the current release, SCOPe 2.08
View in 3D
