Lineage for d1t7pb_ (1t7p B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876219Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2876255Domain d1t7pb_: 1t7p B: [32723]
    Other proteins in same PDB: d1t7pa1, d1t7pa2
    protein/DNA complex; complexed with dg3, mg

Details for d1t7pb_

PDB Entry: 1t7p (more details), 2.2 Å

PDB Description: t7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin
PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d1t7pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7pb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOPe Domain Coordinates for d1t7pb_:

Click to download the PDB-style file with coordinates for d1t7pb_.
(The format of our PDB-style files is described here.)

Timeline for d1t7pb_: