SCOPe 2.07: Domain d1t7pb_: 1t7p B:

Lineage for d1t7pb_ (1t7p B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 protein domains)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (47 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d1t7pb_: 1t7p B: [32723]
   Other proteins in same PDB: d1t7pa1, d1t7pa2
   protein/DNA complex; complexed with dg3, mg

Details for d1t7pb_

PDB Entry: 1t7p, 2.2 Å

PDB Description: t7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin

PDB Compounds: (B:) protein (thioredoxin)

SCOPe Domain Sequences for d1t7pb_:

Sequence; same for both SEQRES and ATOM records:

>d1t7pb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d1t7pb_:

• d1t7pb_ first appeared (with stable ids) in SCOP 1.55
  
• d1t7pb_ appears in SCOPe 2.06