Lineage for d5m4rb_ (5m4r B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733582Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)
  8. 2733617Domain d5m4rb_: 5m4r B: [327221]
    Other proteins in same PDB: d5m4re2
    automated match to d1g8qa_
    complexed with edo, so4

Details for d5m4rb_

PDB Entry: 5m4r (more details), 3.1 Å

PDB Description: structural tuning of cd81lel (space group c2)
PDB Compounds: (B:) CD81 antigen

SCOPe Domain Sequences for d5m4rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m4rb_ a.135.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn
lcpsgsniisnlfkedchqkiddlfsg

SCOPe Domain Coordinates for d5m4rb_:

Click to download the PDB-style file with coordinates for d5m4rb_.
(The format of our PDB-style files is described here.)

Timeline for d5m4rb_: