Lineage for d5m33b1 (5m33 B:113-201)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733579Protein automated matches [256548] (3 species)
    not a true protein
  7. 2733582Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)
  8. 2733586Domain d5m33b1: 5m33 B:113-201 [327210]
    Other proteins in same PDB: d5m33a2, d5m33b2
    automated match to d1g8qa_
    complexed with edo

Details for d5m33b1

PDB Entry: 5m33 (more details), 1.28 Å

PDB Description: structural tuning of cd81lel (space group p21)
PDB Compounds: (B:) CD81 antigen

SCOPe Domain Sequences for d5m33b1:

Sequence, based on SEQRES records: (download)

>d5m33b1 a.135.1.1 (B:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgk

Sequence, based on observed residues (ATOM records): (download)

>d5m33b1 a.135.1.1 (B:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvnnakavvktfhetldccgsstltalttsvlknnlcp
sgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d5m33b1:

Click to download the PDB-style file with coordinates for d5m33b1.
(The format of our PDB-style files is described here.)

Timeline for d5m33b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m33b2