Lineage for d5b1oa1 (5b1o A:223-286)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709045Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2709085Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2709086Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins)
  6. 2709098Protein automated matches [327108] (1 species)
    not a true protein
  7. 2709099Species Escherichia coli [TaxId:562] [327109] (2 PDB entries)
  8. 2709101Domain d5b1oa1: 5b1o A:223-286 [327207]
    Other proteins in same PDB: d5b1oa2
    automated match to d1joya_
    mutant

Details for d5b1oa1

PDB Entry: 5b1o (more details), 2.3 Å

PDB Description: dhp domain structure of envz p248a mutant
PDB Compounds: (A:) Osmolarity sensor protein EnvZ

SCOPe Domain Sequences for d5b1oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1oa1 a.30.2.1 (A:223-286) automated matches {Escherichia coli [TaxId: 562]}
maagvkqladdrtllmagvshdlrtaltrirlatemmseqdgylaesinkdieecnaiie
qfid

SCOPe Domain Coordinates for d5b1oa1:

Click to download the PDB-style file with coordinates for d5b1oa1.
(The format of our PDB-style files is described here.)

Timeline for d5b1oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5b1oa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5b1ob_