SCOPe 2.07: Domain d5b1oa1: 5b1o A:223-286

Lineage for d5b1oa1 (5b1o A:223-286)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 protein domains)

6. Protein automated matches [327108] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [327109] (2 PDB entries)

8. Domain d5b1oa1: 5b1o A:223-286 [327207]
   Other proteins in same PDB: d5b1oa2
   automated match to d1joya_
   mutant

Details for d5b1oa1

PDB Entry: 5b1o, 2.3 Å

PDB Description: dhp domain structure of envz p248a mutant

PDB Compounds: (A:) Osmolarity sensor protein EnvZ

SCOPe Domain Sequences for d5b1oa1:

Sequence; same for both SEQRES and ATOM records:

>d5b1oa1 a.30.2.1 (A:223-286) automated matches {Escherichia coli [TaxId: 562]}
maagvkqladdrtllmagvshdlrtaltrirlatemmseqdgylaesinkdieecnaiie
qfid

Timeline for d5b1oa1:

• d5b1oa1 first appeared in SCOPe 2.06