![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.135: Tetraspanin [48651] (1 superfamily) 5 helices: irregular disulfide-linked array; form homodimer |
![]() | Superfamily a.135.1: Tetraspanin [48652] (1 family) ![]() |
![]() | Family a.135.1.1: Tetraspanin [48653] (2 proteins) |
![]() | Protein automated matches [256548] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries) |
![]() | Domain d5m3dd1: 5m3d D:114-201 [327205] Other proteins in same PDB: d5m3da2, d5m3db2, d5m3dc2, d5m3dd2 automated match to d1g8qa_ complexed with edo, po4 |
PDB Entry: 5m3d (more details), 2.38 Å
SCOPe Domain Sequences for d5m3dd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m3dd1 a.135.1.1 (D:114-201) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn lcpsgsniisnlfkedchqkiddlfsgk
Timeline for d5m3dd1: