SCOP 1.69: Domain d2trxa_: 2trx A:

Lineage for d2trxa_ (2trx A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.1: Thioltransferase [52834] (11 proteins)

6. Protein Thioredoxin [52835] (10 species)

7. Species Escherichia coli [TaxId:562] [52836] (21 PDB entries)

8. Domain d2trxa_: 2trx A: [32719]

Details for d2trxa_

PDB Entry: 2trx, 1.68 Å

PDB Description: crystal structure of thioredoxin from escherichia coli at 1.68 angstroms resolution

SCOP Domain Sequences for d2trxa_:

Sequence; same for both SEQRES and ATOM records:

>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d2trxa_:

• d2trxa_ first appeared (with stable ids) in SCOP 1.55
  
• d2trxa_ appears in SCOP 1.67
  
• d2trxa_ appears in SCOP 1.71
  
• d2trxa_ appears in the current release, SCOPe 2.08