SCOPe 2.06: Domain d5kpqb2: 5kpq B:797-1011

Lineage for d5kpqb2 (5kpq B:797-1011)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)

8. Domain d5kpqb2: 5kpq B:797-1011 [327188]
   Other proteins in same PDB: d5kpqa1, d5kpqb1
   automated match to d4hhyd2
   complexed with 6x2

Details for d5kpqb2

PDB Entry: 5kpq, 2.55 Å

PDB Description: structure of human parp1 catalytic domain bound to a quinazoline-2, 4(1h,3h)-dione inhibitor

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5kpqb2:

Sequence; same for both SEQRES and ATOM records:

>d5kpqb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d5kpqb2:

• d5kpqb2 is new in SCOPe 2.06-stable
  
• d5kpqb2 appears in SCOPe 2.07
  
• d5kpqb2 appears in the current release, SCOPe 2.08