Lineage for d5hrna_ (5hrn A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139404Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2139405Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2139411Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (53 PDB entries)
  8. 2139471Domain d5hrna_: 5hrn A: [327186]
    automated match to d3vq9c_
    protein/DNA complex; complexed with 65p, cac, edo, so4; mutant

Details for d5hrna_

PDB Entry: 5hrn (more details), 1.75 Å

PDB Description: hiv integrase catalytic domain containing f185k mutation complexed with gsk0002
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d5hrna_:

Sequence, based on SEQRES records: (download)

>d5hrna_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd
ngsnftsatvkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d5hrna_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktihtd
ngsnftsatvkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkgysagerivdiiatdi

SCOPe Domain Coordinates for d5hrna_:

Click to download the PDB-style file with coordinates for d5hrna_.
(The format of our PDB-style files is described here.)

Timeline for d5hrna_: