Lineage for d1e0ca2 (1e0c A:136-271)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600298Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 1600299Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 1600333Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
    duplication: consists of two domains of this fold
  6. 1600359Protein Sulfurtransferase [52830] (2 species)
  7. 1600360Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries)
  8. 1600362Domain d1e0ca2: 1e0c A:136-271 [32718]
    complexed with edo, mg, so4

Details for d1e0ca2

PDB Entry: 1e0c (more details), 1.8 Å

PDB Description: sulfurtransferase from azotobacter vinelandii
PDB Compounds: (A:) sulfurtransferase

SCOPe Domain Sequences for d1e0ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}
ggpvalslhdeptasrdyllgrlgaadlaiwdarspqeyrgekvlaakgghipgavnfew
taamdpsralrirtdiagrleelgitpdkeivthcqthhrsgltyliakalgyprvkgya
gswgewgnhpdtpvel

SCOPe Domain Coordinates for d1e0ca2:

Click to download the PDB-style file with coordinates for d1e0ca2.
(The format of our PDB-style files is described here.)

Timeline for d1e0ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e0ca1