SCOP 1.67: Domain d1e0ca1: 1e0c A:1-135

Lineage for d1e0ca1 (1e0c A:1-135)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families)
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (3 proteins)
   duplication: consists of two domains of this fold

6. Protein Sulfurtransferase [52830] (1 species)

7. Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries)

8. Domain d1e0ca1: 1e0c A:1-135 [32717]

Details for d1e0ca1

PDB Entry: 1e0c, 1.8 Å

PDB Description: sulfurtransferase from azotobacter vinelandii

SCOP Domain Sequences for d1e0ca1:

Sequence; same for both SEQRES and ATOM records:

>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii}
mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap
glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw
laedrplsrelpapa

Timeline for d1e0ca1:

• d1e0ca1 first appeared (with stable ids) in SCOP 1.55
  
• d1e0ca1 appears in SCOP 1.65
  
• d1e0ca1 appears in SCOP 1.69
  
• d1e0ca1 appears in the current release, SCOPe 2.08