![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (3 families) ![]() |
![]() | Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins) |
![]() | Protein Rhodanese [52828] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) |
![]() | Domain d1rhd_2: 1rhd 150-293 [32716] |
PDB Entry: 1rhd (more details), 2.5 Å
SCOP Domain Sequences for d1rhd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhd_2 c.46.1.2 (150-293) Rhodanese {Cow (Bos taurus)} aifkatlnrsllktyeqvlenleskrfqlvdsraqgrylgtqpepdavgldsghirgsvn mpfmdfltengfekspeelramfeakkvdltkpliatcrkgvtachialaaylcgkpdva iydgswfewfhrappetwvsqgkg
Timeline for d1rhd_2: