| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
| Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species) protein duplication: contains two Tudor domains in tandem |
| Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
| Domain d5j26a2: 5j26 A:1538-1603 [327157] Other proteins in same PDB: d5j26a1, d5j26b_ automated match to d1ssfa2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5j26 (more details), 2.5 Å
SCOPe Domain Sequences for d5j26a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j26a2 b.34.9.1 (A:1538-1603) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglg
Timeline for d5j26a2: