![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
![]() | Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species) protein duplication: contains two Tudor domains in tandem |
![]() | Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
![]() | Domain d5j26a1: 5j26 A:1487-1537 [327156] Other proteins in same PDB: d5j26a2, d5j26b_ automated match to d2lvma1 |
PDB Entry: 5j26 (more details), 2.5 Å
SCOPe Domain Sequences for d5j26a1:
Sequence, based on SEQRES records: (download)
>d5j26a1 b.34.9.1 (A:1487-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp
>d5j26a1 b.34.9.1 (A:1487-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vglrvvakwssngyfysgkitrdvkykllfddgyecdvlgkdillcdp
Timeline for d5j26a1: