SCOPe 2.08: Domain d5gpia_: 5gpi A:

Lineage for d5gpia_ (5gpi A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (3 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327137] (14 PDB entries)

8. Domain d5gpia_: 5gpi A: [327153]
   Other proteins in same PDB: d5gpib_, d5gpid_, d5gpif_, d5gpih_
   automated match to d2ggva_

Details for d5gpia_

PDB Entry: 5gpi, 1.58 Å

PDB Description: crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor

PDB Compounds: (A:) NS2B cofactor

SCOPe Domain Sequences for d5gpia_:

Sequence; same for both SEQRES and ATOM records:

>d5gpia_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

Timeline for d5gpia_:

• d5gpia_ first appeared in SCOPe 2.06
  
• d5gpia_ appears in SCOPe 2.07