SCOPe 2.07: Domain d5gpig_: 5gpi G:

Lineage for d5gpig_ (5gpi G:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (3 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327137] (14 PDB entries)

8. Domain d5gpig_: 5gpi G: [327152]
   Other proteins in same PDB: d5gpib_, d5gpid_, d5gpif_, d5gpih_
   automated match to d2ggva_

Details for d5gpig_

PDB Entry: 5gpi, 1.58 Å

PDB Description: crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor

PDB Compounds: (G:) NS2B cofactor

SCOPe Domain Sequences for d5gpig_:

Sequence; same for both SEQRES and ATOM records:

>d5gpig_ g.96.1.0 (G:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslvee

Timeline for d5gpig_:

• d5gpig_ first appeared in SCOPe 2.06
  
• d5gpig_ appears in the current release, SCOPe 2.08